Lepirudin is an anticoagulant that acts as a direct thrombin inhibitor. Lepirudin binds to both free and clot-bound thrombin. Lepirudin is approved for the treatment of heparin-induced thrombocytopenia (HIT). Sequence: LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ Source summary: Lepirudin is a recombinant hirudin derivative used in anticoagulation research and thrombin inhibition studies. Enhance your projects with this reliable peptide. Order now!
Products > Drug Discovery > Inhibitor | Products > Drug Discovery > Inhibitor | Cardiovascular and blood system | Thrombin
Please leave a message for us or use the following ways to contact us, we will reply to you as soon as possible, and provide you with the most sincere service, thank you.