Other grades of this product :
| GALANIN, HUMAN Basic information |
| Product Name: | GALANIN, HUMAN | | Synonyms: | H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-OH;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER;GALANIN, HUMAN;GALANIN (1-30) (HUMAN);M.W. 3157.41 C139H210N42O43;GALANIN, HUMANGALANIN;Galanin, people | | CAS: | 119418-04-1 | | MF: | C139H210N42O43 | | MW: | 3157.41 | | EINECS: | | Product Categories: | Peptide;Galanins;Neuropeptides;Peptides for Cell Biology;Galanin receptor | | Mol File: | 119418-04-1.mol |
| GALANIN, HUMAN Chemical Properties |
| storage temp. | −20°C | | form | powder |
| GALANIN, HUMAN Usage And Synthesis |
| Uses | Galanin human has been used in immunohistochemistry performed on ileums of pigs to study the effect of the mycotoxin zearalenone on the expression of intestinal peptides. | | General Description | Galanin (GAL) is a neuropeptide composed of 29 amino acids. It has wide range of expression in central and peripheral nervous system. It acts as a ligand for three G-protein coupled receptor (GPCR) subtypes called GalR1, GalR2 and GalR3. | | Biochem/physiol Actions | Galanin (GAL) is involved in multiple physiological actions such as, nociception, cognition, memory, hunger, hormone and neurotransmitter release, and cell growth. It also controls the release of gastric acid, plays a role in the contraction of intestines, and suppresses the secretion of pancreatic peptides. This peptide is up-regulated in colorectal cancer (CRC), which relates to aggressive phenotype and poor prognosis of patients with stage II CRC. Studies in Chinese Han female population show that polymorphisms in this gene are linked to susceptibility to depression. |
| GALANIN, HUMAN Preparation Products And Raw materials |
|