CECROPIN A

CAS No.：80451-04-3

Important Notice

This product is a chemical product/pharmaceutical intermediate. It is not a drug, an active pharmaceutical ingredient (API), or a pharmaceutical-grade material. It has not been granted a drug approval number or a Chemical Drug Substance Approval Notice, has not passed drug-related review and approval, and is not manufactured, tested, or released in accordance with pharmaceutical GMP.
This product is intended solely for non-clinical research, process development, quality studies, further chemical processing, or chemical synthesis. It must not be used in drug-product manufacturing, clinical trials, clinical diagnosis, or administration to humans or animals, or be sold, used as an input, submitted for regulatory filing, or released as an API or pharmaceutical material.
The purchaser must not use this product, or supply it to another party, for personal consumption, sports or fitness, weight loss, health supplements, food, or animal feed.

View the full Disclaimer

Other grades of this product :

CECROPIN A Basic information

Product Name:	CECROPIN A
Synonyms:	LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;CECROPIN A;CECROPIN A, PORCINE;H-LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2;Cecropin A?/Cecropin A, porcine
CAS:	80451-04-3
MF:	C184H313N53O46
MW:	4003.78152
EINECS:
Product Categories:	peptide
Mol File:	80451-04-3.mol

CECROPIN A Chemical Properties

storage temp.	-20°C
form	powder

Safety Information

WGK Germany

MSDS Information

Provider	Language
SigmaAldrich	English

CECROPIN A Usage And Synthesis

Uses	Cecropin A is an antibacterial peptide originally identified in moths.
Uses	Cecropin A has been used as an antimicrobial peptide (AMP): to test its cytotoxic effect on breast adenocarcinoma (MDA-MB-231) and human mesothelioma (M14K) cell lines in ultrasensitive radial diffusion assay against E coli to test Galleria mellonella protein 24 and apolipophorin III effects to test its minimal inhibitory concentrations (MICs) in sensitivity assay for Photorhabdus variants
General Description	Cecropin A belongs to cecropin class and comprises 37 amino acid residues in L configuration. Structurally, this peptide has a C-terminal hydrophobic α-helical structure and the amphipathic N-terminal end. Cecropin A is linear and cationic in nature.
Biochem/physiol Actions	Cecropin A interacts with cell membranes and makes it permeable for electrolytes. Cecropin A thus, favors cytolysis and finally cell death in the hepatocellular carcinoma and lymphoma. The synthetic cecropin A in transgenic rice confers protection against bacterial as well as fungal pathogens.

CECROPIN A Preparation Products And Raw materials

Welcome！

Please leave a message for us or use the following ways to contact us, we will reply to you as soon as possible, and provide you with the most sincere service, thank you.

NO. 18 ,Wujiang Road, Wulidian Street, Jiangbei District, Chongqing
+86-23-6139-8061 +86-13650506873
danny@chemdad.com sales@chemdad.com
www.chemdad.com
WhatsApp +86-13650506873