PACAP (1-27), human, ovine, rat

Overview

Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 Source summary: PACAP (1-27) is a neuropeptide used in brain and immune system research. Available for bulk—contact us for pricing and availability!

Application

Products > Drug Discovery > Inhibitor | Products > Drug Discovery > Inhibitor | Endocrinology and Metabolic Disease | PACAP Receptors

Product Information

• Catalog No.: B2693-163049
• CAS No.: 127317-03-7
• Molecular Formula: C142H224N40O39S
• Molecular Weight: 3147.60
• Purity: ≥98% by HPLC
• Storage: Store at -20°C
• Solubility: Soluble in Water (1 mg/mL), DMSO

Source

Original product source