LL-37, Human

Overview

LL-37 is a cationic and α-helical antimicrobial peptide. It can inhibit growth of Gram-positive E. coli D21 and Gram-negative B. megatarium in a concentration-dependent manner. LL-37 can promote wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Sequence: [LL-37, 37 aa] Source summary: LL-37, Human is a cationic antimicrobial peptide involved in innate immunity, used in infection and inflammation research. Order this peptide today!

Application

Products > Drug Discovery > Inhibitor > Other Inhibitors | Products > Drug Discovery > Inhibitor

Product Information

• Catalog No.: B2693-169481
• CAS No.: 154947-66-7
• Molecular Formula: C205H340N60O53
• Molecular Weight: 4493.25
• Purity: 98%
• Storage: Store at -20°C
• Solubility: Soluble in Water (1 mg/mL)

Source

Original product source