β-Amyloid (1-40)

Overview

β-Amyloid (1-40) is a peptide fragment derived from the amyloid precursor protein, playing a pivotal role in the study of neurodegenerative processes. It consists of 40 amino acids and is a major component of amyloid plaques found in the brain. Researchers utilize β-Amyloid (1-40) to investigate protein aggregation, fibril formation, and their implications in cellular environments. Its biochemical properties make it an essential compound for understanding the molecular mechanisms underlying peptide interactions and conformational changes. Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Source summary: β-Amyloid (1-40) peptide for research use—synthetic Aβ(1–40) fragment for biochemical studies, aggregation assays, and lab experiments.

Application

Products > Drug Discovery > Inhibitor | Products > Drug Discovery > Inhibitor | Alzheimer's disease | Amyloid Precursor Protein Secretase

Product Information

• Catalog No.: B2693-163617
• CAS No.: 131438-79-4
• Molecular Formula: C194H295N53O58S
• Molecular Weight: 4329.8599999999997
• Purity: 95%
• Storage: Store at -20°C

Source

Original product source