Lepirudin

Overview

Lepirudin is an anticoagulant that acts as a direct thrombin inhibitor. Lepirudin binds to both free and clot-bound thrombin. Lepirudin is approved for the treatment of heparin-induced thrombocytopenia (HIT). Sequence: LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ Source summary: Lepirudin is a recombinant hirudin derivative used in anticoagulation research and thrombin inhibition studies. Enhance your projects with this reliable peptide. Order now!

Application

Products > Drug Discovery > Inhibitor | Products > Drug Discovery > Inhibitor | Cardiovascular and blood system | Thrombin

Product Information

• Catalog No.: B0084-445169
• CAS No.: 138068-37-8
• Molecular Formula: C287H440N80O111S6
• Molecular Weight: 6979.41

Source

Original product source