Nogo-66 (1-40)

Overview

Nogo-66 (1-40), a peptide fragment corresponding to residues 1-40 of Nogo-66, acts as a competitive antagonist at the Nogo-66 receptor (NgR), which blocks Nogo-66 or CNS myelin inhibition of axonal outgrowth in vitro, demonstrating that NgR mediates a significant portion of axonal outgrowth inhibition by myelin. Sequence: RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS Source summary: Nogo-66 (1-40) is a peptide fragment crucial for research on neural growth inhibition and regeneration processes. Enhance your study's depth and precision. Order now!

Application

Products > Drug Discovery > Inhibitor > Other Inhibitors | Products > Drug Discovery > Inhibitor

Product Information

• Catalog No.: B1370-038234
• CAS No.: 475221-20-6
• Molecular Formula: C206H324N56O65
• Molecular Weight: 4625.16
• Purity: >95%
• Storage: Store at 2-8°C
• Solubility: Soluble in DMSO

Source

Original product source