Human neutrophil peptide-1

Overview

Human neutrophil peptide-1 is an antimicrobial peptide found in Homo sapiens (Human). It belongs to the alpha-defensin family and has antimicrobial activity against gram-negative bacteria, gram-positive bacteria and Fungi. Sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: Cys2-Cys30, Cys4-Cys19, Cys9-Cys29) Source summary: Human neutrophil peptide-1 is a key antimicrobial peptide with significant roles in immune response and pathogen defense studies. Inquire now for research applications!

Application

Products > Drug Discovery > Inhibitor | Products > Drug Discovery > Inhibitor | Infection | Antibacterial

Product Information

• Catalog No.: B1370-046426
• CAS No.: 99287-08-8
• Molecular Formula: C150H222N44O38S6
• Molecular Weight: 3442.03
• Purity: >95%
• Storage: Store at -20°C
• Solubility: Soluble in Water

Source

Original product source