VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Overview

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo . VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.

Application

Products | Products > Peptides | Products > Disease Areas > Neurological, Eye or Ear Disease | Products > Signaling Pathways > Membrane Transporter/Ion Channel | Products > Signaling Pathways > Neuronal Signaling | Products > Research Areas > Neurological Disease | Products > Signaling Pathways > iGluR

Product Information

• Catalog No.: HY-P3431
• CAS No.: 2279952-25-7
• Molecular Formula: C171H250N40O39
• Molecular Weight: 3490.06
• Purity: 99.98%
• Storage: Please store the product under the recommended conditions in the Certificate of Analysis.

Source

Original product source